PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C006597P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 481aa    MW: 54165.7 Da    PI: 6.8089
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C006597P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1184.8e-37130206177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +Cqv+gCe+d+se+k yhrrh+vC  +++a++v+++++++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k 
  MELO3C006597P1 130 RCQVPGCEVDISELKGYHRRHRVCLRCANATAVVIDDETKRYCQQCGKFHVLSDFDEGKRSCRRKLERHNNRRRRKP 206
                     6************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-28126192IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.333128205IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.59E-34129209IPR004333Transcription factor, SBP-box
PfamPF031101.7E-27131205IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MENPPPSPLP HPLPDAEMDI QLPMADDPST ALWDLGDLLD FAADDQFSFS LEQDNLPSAS  60
SHYLEIQSQT PPSNSDRIRK RDPRLTCSNF LAGRVPCACP EVDAMLEEEA AAAPGKKRAR  120
TARVGAGTVR CQVPGCEVDI SELKGYHRRH RVCLRCANAT AVVIDDETKR YCQQCGKFHV  180
LSDFDEGKRS CRRKLERHNN RRRRKPVDST TSMESDRSSM QLEDVSCDGD IGKDNILFNN  240
QTDQKEVVHL ESEDGLVTST VCSAPDLQNN VESGLTLVGT GEAQVDRGKD NSKSLASSYC  300
DNKSTYSSMC PTGRISFKLY DWNPAEFPRR LRLQIFEWLA NMPVELEGYI RPGCIILTAF  360
VAMPKFMWIK LLEDPTTHVH NFVVARGRPL WGRGNILVYL NNMIFRAMEG ESVMKIEMDM  420
QAPRLHYVHP TCFEAGKPME FVACGSHLRQ PKFRYYNIKI LLHIQLTSKK CLVFAKGKED  480
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A3e-42126209184squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191203RRKLERHNNRRRR